NLRP5 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A9886
Artikelname: NLRP5 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A9886
Hersteller Artikelnummer: A9886
Alternativnummer: ABB-A9886-20UL,ABB-A9886-100UL,ABB-A9886-500UL,ABB-A9886-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MATER, NALP5, PAN11, PYPAF8, CLR19.8, NLRP5
The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.
Klonalität: Polyclonal
Molekulargewicht: 134kDa
NCBI: 126206
UniProt: P59047
Reinheit: Affinity purification
Sequenz: TMTDQGPSKEKVPGISQAVQQDSATAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENT
Target-Kategorie: NLRP5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway.
Western blot analysis of lysates from SKOV3 cells, using NLRP5 Rabbit pAb (A9886) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20S.