FABP12 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A9894
- Bilder (1)
| Artikelname: | FABP12 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A9894 |
| Hersteller Artikelnummer: | A9894 |
| Alternativnummer: | ABB-A9894-20UL,ABB-A9894-100UL,ABB-A9894-500UL,ABB-A9894-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FABP12 |
| Predicted to enable lipid binding activity. Predicted to be located in cytosol. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 16kDa |
| NCBI: | 646486 |
| UniProt: | A6NFH5 |
| Reinheit: | Affinity purification |
| Sequenz: | MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS |
| Target-Kategorie: | FABP12 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat, ResearchArea: Endocrine Metabolism,Lipid Metabolism. |

