SAE1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SAE1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9960
• Hersteller Artikelnummer: A9960
• Alternativnummer: ABB-A9960-100UL,ABB-A9960-20UL,ABB-A9960-1000UL,ABB-A9960-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AOS1, SUA1, UBLE1A, HSPC140, SAE1

Produktbeschreibung

Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1, MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 38kDa
• NCBI: 10055
• UniProt: Q9UBE0
• Reinheit: Affinity purification
• Sequenz: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGR
• Target-Kategorie: SAE1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway.

Bilder

Western blot analysis of various lysates using SAE1 Rabbit pAb (A9960) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.