AGK Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: AGK Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9976
• Hersteller Artikelnummer: A9976
• Alternativnummer: ABB-A9976-100UL,ABB-A9976-20UL,ABB-A9976-500UL,ABB-A9976-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MULK, CATC5, CTRCT38, MTDPS10, AGK

Produktbeschreibung

The protein encoded by this gene is a mitochondrial membrane protein involved in lipid and glycerolipid metabolism. The encoded protein is a lipid kinase that catalyzes the formation of phosphatidic and lysophosphatidic acids. Defects in this gene have been associated with mitochondrial DNA depletion syndrome 10.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 55750
• UniProt: Q53H12
• Reinheit: Affinity purification
• Sequenz: KAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSPEVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHVEGTECLQASQCTLLIPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLTSPTQ
• Target-Kategorie: AGK
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat, ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Kinase,Endocrine Metabolism,Lipid Metabolism.

Bilder

Western blot analysis of lysates from SK-MEL-28 cells, using AGK Rabbit pAb (A9976) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.