FTSJ3 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: FTSJ3 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9994
• Hersteller Artikelnummer: A9994
• Alternativnummer: ABB-A9994-20UL,ABB-A9994-100UL,ABB-A9994-1000UL,ABB-A9994-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SPB1, EPCS3, FTSJ3

Produktbeschreibung

Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 97kDa
• NCBI: 117246
• UniProt: Q8IY81
• Reinheit: Affinity purification
• Sequenz: EGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK
• Target-Kategorie: FTSJ3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Stem Cells,Germline Stem Cells.

Bilder

Western blot analysis of various lysates using FTSJ3 Rabbit pAb (A9994) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.