Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein (Primary Amine Labeling)

Produktübersicht

• Artikelname: Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein (Primary Amine Labeling)
• Artikelnummer: ABB-RP00362BLQ
• Hersteller Artikelnummer: RP00362BLQ
• Alternativnummer: ABB-RP00362BLQ-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Leu29-Ala216
• Alternative Synonym: CD134, OX40, OX40L receptor, TNFRSF4, ACT-135, Ly-70, OX40 homologue, TXGP1L, IMD16

Produktbeschreibung

Tumor necrosis factor receptor superfamily, member 4 (TNFRSF4), also known as CD134 and OX40 receptor. OX40 is a secondary co-stimulatory immune checkpoint molecule, expressed after 24 to 72 hours following activation, its ligand, OX40L, is also not expressed on resting antigen presenting cells, but is following their activation.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 46.8 kDa
• NCBI: 7293
• UniProt: P43489
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Sequenz: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
• Target-Kategorie: OX40/TNFRSF4/CD134 (Primary Amine Labeling)

Anwendungsbeschreibung

• Application Verdünnung: Supplied as 0.22 µm filtered solution in PBS (pH 7.4).
• Anwendungsbeschreibung: ResearchArea: Biosimilar Drug Targets, Bio-Markers & CD Antigens

Bilder

Biotinylated Recombinant Human TNFRSF4/OX40/CD134 Protein (Primary Amine Labeling) was determined by Tris-Bis PAGE under reducing conditions.