Recombinant Human HGF receptor/c-MET/MET Protein

Artikelnummer: ABB-RP00419
Artikelname: Recombinant Human HGF receptor/c-MET/MET Protein
Artikelnummer: ABB-RP00419
Hersteller Artikelnummer: RP00419
Alternativnummer: ABB-RP00419-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Immunogen: Glu25-Thr932
Alternative Synonym: MET, oncogene MET, HGF R, HGF/SF receptor, AUTS9, cMET, Met (c-Met), RCCP2, SF receptor
c-Met, also called tyrosine-protein kinase Met or hepatocyte growth factor receptor (HGF R), is a protein that in humans is encoded by the MET gene.The protein possesses tyrosine kinase activity. The primary single chain precursor protein is post-transla
Konzentration: < 1 EU/µg of the protein by LAL method
Molekulargewicht: 32.5, 95.9 kDa
NCBI: 4233
UniProt: P08581
Reinheit: > 95% by SDS-PAGE
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: ECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRI
Target-Kategorie: HGF R/c-MET
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.