Recombinant Human DPEP1 Protein

Artikelnummer: ABB-RP01097LQ
Artikelname: Recombinant Human DPEP1 Protein
Artikelnummer: ABB-RP01097LQ
Hersteller Artikelnummer: RP01097LQ
Alternativnummer: ABB-RP01097LQ-10UG,ABB-RP01097LQ-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Asp17-Ser385
Alternative Synonym: DPEP1,MBD1,MDP,RDP
This protein is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukotriene D4 to leukotriene E4. This protein uses zinc as a cofactor and acts as a disulfide-linked homodimer. Two transcript variants encoding the same protein have been found for this gene.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 42.1 kDa
NCBI: 1800
UniProt: P16444
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Supplied as a 0.2 µm filtered solution of PBS, 10% Glycerol, pH 7.4.Contact us for customized product form or formulation.
Sequenz: DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNY
Target-Kategorie: DPEP1
Application Verdünnung: Supplied as a 0.2 µm filtered solution of PBS, 10% Glycerol, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human DPEP1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.