Recombinant Human Argonaute-2/AGO2 Protein, Virus

Artikelnummer: ABB-RP01132
Artikelname: Recombinant Human Argonaute-2/AGO2 Protein, Virus
Artikelnummer: ABB-RP01132
Hersteller Artikelnummer: RP01132
Alternativnummer: ABB-RP01132-100UG
Hersteller: ABclonal
Wirt: Virus
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Met1-Ala859
Alternative Synonym: AGO2,CASC7,EIF2C2,LINC00980,PPD,Q10,protein argonaute-2,Argonaute 2,EIF2C2
This protein is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 99 kDa
Tag: N-6*His
NCBI: 27161
UniProt: Q9UKV8
Quelle: Baculovirus-Infected Sf9 Cells
Reinheit: 85 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution 20mM Tris, 500mM NaCl, pH7.4,10% glycerol,2mM DTT.Contact us for customized product form or formulation.
Sequenz: MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQR
Target-Kategorie: Argonaute-2
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution 20mM Tris, 500mM NaCl, pH7.4,10% glycerol,2mM DTT.Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human Argonaute-2/AGO2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.