Recombinant Mouse IL-4 Protein, Human

Artikelnummer: ABB-RP01161
Artikelname: Recombinant Mouse IL-4 Protein, Human
Artikelnummer: ABB-RP01161
Hersteller Artikelnummer: RP01161
Alternativnummer: ABB-RP01161-50UG,ABB-RP01161-10UG,ABB-RP01161-20UG,ABB-RP01161-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: His23-Ser140
Alternative Synonym: Il-4, BSF-1,IL4
Interleukin-4, also known as IL4, is a secreted protein that belongs to the IL-4 / IL-13 family. Interleukin-4 / IL4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation. It enhances both secretion and cell surface expression of IgE and IgG1. Interleukin-4 / IL4 also regulates the expression of the low-affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Interleukin-4 is essential for the switching of B cells to IgE antibody production and the maturation of T helper (Th) cells toward the Th2 phenotype.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 14.15 kDa
Tag: C-His
NCBI: 16189
UniProt: P07750
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequenz: HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Target-Kategorie: IL-4
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Interleukin,Cell Culture related