Recombinant Mouse CSF-1/M-CSF Protein, Human

Artikelnummer: ABB-RP01216
Artikelname: Recombinant Mouse CSF-1/M-CSF Protein, Human
Artikelnummer: ABB-RP01216
Hersteller Artikelnummer: RP01216
Alternativnummer: ABB-RP01216-500UG,ABB-RP01216-10UG,ABB-RP01216-50UG,ABB-RP01216-20UG,ABB-RP01216-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Met1-Glu262
Alternative Synonym: MCSF,M-CSF,CSF-1,Lanimostim,CSF1
Macrophage colony-stimulating factor 1, also known as CSF-1, M-CSF, is a single-pass membrane protein which is disulfide-linked as a homodimer or heterodimer. Granulocyte / macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. M-CSF/CSF-1 is known to facilitate monocyte survival, monocyte-to-macrophage conversion, and macrophage proliferation. M-CSF/CSF-1 is a secreted cytokine which influences hemopoietic stem cells to differentiate into macrophages or other related cell types. It binds to the Colony stimulating factor 1 receptor. M-CSF/CSF-1 may also be involved in development of the placenta. The active form of M-CSF/CSF-1 is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. M-CSF/CSF-1 induces cells of the monocyte/macrophage lineage. It also plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. Upregulation of M-CSF/CSF-1 in the infarcted myocardium may have an active role in healing not only through its effects on cells of monocyte/macrophage lineage, but also by regulating endothelial cell chemokine expression.
Konzentration: < 0.01 EU/µg of the protein by LAL method.
Molekulargewicht: 30.19 kDa
Tag: C-His
NCBI: 12977
UniProt: P07141
Quelle: HEK293 cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequenz: MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPR
Target-Kategorie: CSF-1/M-CSF
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors,Cell Culture related