Recombinant SARS-CoV-2 Spike S2 ECD Protein, Virus

Produktübersicht

• Artikelname: Recombinant SARS-CoV-2 Spike S2 ECD Protein, Virus
• Artikelnummer: ABB-RP01267
• Hersteller Artikelnummer: RP01267
• Alternativnummer: ABB-RP01267-100UG
• Hersteller: ABclonal
• Wirt: Virus
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Immunogen: Ser686-Pro1213
• Alternative Synonym: 2019-nCoV RBD Protein, Envelope, NCP-CoV RBD Protein, S glycoprotein Subunit1 RBD Protein, S1-RBD protein, SARS-CoV-2 Spike RBD (N501Y), Spike, Spike ECD, Spike RBD, Spike S1, Spike S2, Spike S2 ECD, novel coronavirus RBD Protein, sars-cov-2

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 58.8kDa
• NCBI: 43740568
• Reinheit: 90 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of sterile 20 mM PB, 300 mM NaCl, pH 7.0. or Supplied as a 0.22 µm filtered solution in 20 mM PB, 300 mM NaCl, pH 7.0Contact us for customized product form or formulation.
• Sequenz: SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSS
• Target-Kategorie: SARS-CoV-2 Spike S2 ECD

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of sterile 20 mM PB, 300 mM NaCl, pH 7.0. or Supplied as a 0.22 µm filtered solution in 20 mM PB, 300 mM NaCl, pH 7.0Contact us for customized product form or formulation.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: SARS-CoV-2 antigens

Bilder

Recombinant SARS-CoV-2 Spike S2 ECD Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.