Recombinant Mouse IL-19 Protein, Human

Artikelnummer: ABB-RP01890
Artikelname: Recombinant Mouse IL-19 Protein, Human
Artikelnummer: ABB-RP01890
Hersteller Artikelnummer: RP01890
Alternativnummer: ABB-RP01890-50UG,ABB-RP01890-500UG,ABB-RP01890-10UG,ABB-RP01890-100UG,ABB-RP01890-1000UG,ABB-RP01890-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Leu25-Ala176
Alternative Synonym: IL-10C, IL19, IL-19, interleukin 19, MDA1, melanoma differentiation associated protein-like protein, NG.1Melanoma differentiation-associated protein-like protein, ZMDA1interleukin-19
Interleukin 19 (IL-19) is a member of the IL-10 family of cytokines. The IL-10 family is a class II alpha -helical collection of cytokines that contains two groups, a viral homolog and a cellular homolog group. Within the cellular homolog group, there are two additional groupings, one which uses IL-10 R2 as a signal transducing receptor (IL-10, IL-22 and IL-26), and one which uses IL-20 R2 as a signal transducing receptor (IL-19, IL-20 and IL-24). Mouse IL-19 is synthesized as a 176 amino acid (aa) precursor that contains a 24 aa signal sequence and a 152 aa mature region . Based on human studies, it is expected to be secreted as a glycosylated monomer, 35 - 45 kDa in size. IL-19 is unusual in that it contains seven amphipathic helices. Mature mouse IL-19 shares 69% aa sequence identity with the mature human IL-19, and 85% and 68% aa identity to unpublished Genbank sequences for rat and canine IL-19, respectively. Although mouse IL-19 is active on human cells, human IL-19 is not active on mouse cells . IL-19 expression is limited to activated keratinocytes and monocytes, with a possible contribution from B cells . IL-19 binds a receptor complex consisting of the IL-20 receptor alpha (also known as IL-20 R1) and the IL-20 receptor beta (IL-20 R2) . This receptor complex is also shared by IL-20 and IL-24. Notably, IL-19 is reported to actually bind to IL-20 R2, which is generally considered to be only the signal transducing receptor subunit. Functionally, it has been reported that IL-19 both will and will not induce IL-6 and TNF production by monocytes . It does, however, seem to drive T-helper cell differentiation towards a Th2 response, inducing both IL-10 and production of itself .
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 18.45 kDa
NCBI: 329244
UniProt: Q8CJ70
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Target-Kategorie: IL19
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors