Recombinant Mouse Dkk-3 Protein, Human

Artikelnummer: ABB-RP01894
Artikelname: Recombinant Mouse Dkk-3 Protein, Human
Artikelnummer: ABB-RP01894
Hersteller Artikelnummer: RP01894
Alternativnummer: ABB-RP01894-500UG,ABB-RP01894-50UG,ABB-RP01894-20UG,ABB-RP01894-10UG,ABB-RP01894-100UG,ABB-RP01894-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ala 22 - Ile 349
Alternative Synonym: Dkk3,Dickkopf-related protein 3, Dickkopf-3, Dkk-3, mDkk-3
DKK3 (dickkopf related protein 3) is a member of the dickkopf-related family consisting of DKK1, DKK2, DKK3 and DKK4. It is a secreted protein, and also known as REIC (Reduced Expansion in Immortalized Cells). The DKK3 protein is proposed to function as a secreted tumor suppressor since it is downregulated in a number of cancer cells and prostate cancer tissue and may be a promising candidate molecule for therapeutic interference. DKK3 protein is also a negative regulator of beta-catenin and its downregulation contribute to an activation of the beta-catenin signaling pathway.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 37.14 kDa
NCBI: 50781
UniProt: Q9QUN9
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: APSPTVTWTPAEPGPALNYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKTSSEVNLASLPPNYHNETSTETRVGNNTVHVHQEVHKITNNQSGQVVFSETVITSVGDEEGKRSHECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCTQKATKGGNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCASGLLCQPH
Target-Kategorie: Dkk3
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein,Cell Culture related