Recombinant Human IFN-alpha 21 Protein

Artikelnummer: ABB-RP01900
Artikelname: Recombinant Human IFN-alpha 21 Protein
Artikelnummer: ABB-RP01900
Hersteller Artikelnummer: RP01900
Alternativnummer: ABB-RP01900-50UG,ABB-RP01900-500UG,ABB-RP01900-10UG,ABB-RP01900-1000UG,ABB-RP01900-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Cys24-Glu189
Alternative Synonym: IFNA21, IFN-alpha 21, IFNalpha F, IFN-alpha F, IFN-alpha-21, IFN-alphaI, interferon alpha-21, Interferon alpha-F, interferon, alpha 21, LeIF F, leukocyte interferon protein, MGC126687, MGC126689
Interferons (IFN) are a family of cytokines with potent antiviral, anti-proliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Human IFNA2 was originally cloned in the early '80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology . Structurally, type I IFNs belong to the class of five helical bundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds . There is not a mouse homolog for IFNA21, but mature human IFNA21 is identical to chimpanzee IFNA21. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit) . Individual IFNA subtypes are known to display unique efficacies to viral protection, with IFNA21 displaying intermediate activity inducing interferon stimulating genes. Further, human IFNA21 has shown weak anti-viral activity against viruses such as metapneumovirus .
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 20.15 kDa
NCBI: 3452
UniProt: P01568
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
Target-Kategorie: IFNA21
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors