Recombinant Mouse CCL17/TARC Protein, Yeast

Artikelnummer: ABB-RP01905
Artikelname: Recombinant Mouse CCL17/TARC Protein, Yeast
Artikelnummer: ABB-RP01905
Hersteller Artikelnummer: RP01905
Alternativnummer: ABB-RP01905-10UG,ABB-RP01905-100UG,ABB-RP01905-20UG,ABB-RP01905-1000UG,ABB-RP01905-50UG,ABB-RP01905-500UG
Hersteller: ABclonal
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ala24-Pro93
Alternative Synonym: Ccl17, Tarc,C-C motif chemokine 17, ABCD-2, CC chemokine TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine
TARC ligand (CCL17) belongs to the CC chemokine family. It is a small cytokine and the gene is located on q arm of chromosome 16, in humans, along with other chemokines. TARC specifically binds to T-cells and interacts with chemokine receptors CCR4 and CCR8. It plays an important role in T cell development in thymus as well as in trafficking and activation of mature T cells.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 8.76 kDa
NCBI: 20295
UniProt: Q9WUZ6
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Target-Kategorie: Ccl17
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related