Recombinant Mouse CCL4/MIP-1beta Protein, Yeast

Artikelnummer: ABB-RP01907
Artikelname: Recombinant Mouse CCL4/MIP-1beta Protein, Yeast
Artikelnummer: ABB-RP01907
Hersteller Artikelnummer: RP01907
Alternativnummer: ABB-RP01907-50UG,ABB-RP01907-500UG,ABB-RP01907-10UG,ABB-RP01907-100UG,ABB-RP01907-1000UG,ABB-RP01907-20UG
Hersteller: ABclonal
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ala24-Asn92
Alternative Synonym: Ccl4, Mip1b, Scya4,C-C motif chemokine 4, Immune activation protein 2, ACT-2, ACT2, Macrophage inflammatory protein 1-beta, MIP-1-beta, Protein H400, SIS-gamma, Small-inducible cytokine A4
CCL4, also known as macrophage inflammatory protein 1 beta (MIP-1 beta ), is a 12 kDa beta chemokine that is secreted at sites of inflammation by activated leukocytes, lymphocytes, vascular endothelial cells, and pulmonary smooth muscle cells. CCL4 attracts a variety of immune cells to sites of microbial infection as well as to other pathologic inflammation such as allergic asthma and ischemic myocardium . A CCL4 deficiency in mice promotes the development of autoantibodies, possibly as a result of compromised regulatory T cell recruitment . CCL4 is secreted from activated monocytes as a heterodimer with CCL3/MIP-1 alpha . The first two N-terminal amino acids can be cleaved from human CCL4 by CD26/DPPIV . Both the full length and truncated forms exert biological activity through CCR5, Both forms of CCL4 block HIV-1 infection of T cells by inducing the downregulation of CCR5.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 8.67 kDa
NCBI: 20303
UniProt: P14097
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Target-Kategorie: Ccl4
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related