Recombinant Rat TNF-alpha Protein, Human

Artikelnummer: ABB-RP01908
Artikelname: Recombinant Rat TNF-alpha Protein, Human
Artikelnummer: ABB-RP01908
Hersteller Artikelnummer: RP01908
Alternativnummer: ABB-RP01908-50UG, ABB-RP01908-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Immunogen: Leu80-Leu235
Alternative Synonym: Tnf, Tnfa, Tnfsf2,Tumor necrosis factor, Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2, TNF-a, Cleaved into: Tumor necrosis factor, membrane form, N-terminal fragment, NTF, Intracellular domain 1, ICD1, Intracellular domain 2, I
Tumor necrosis factor alpha (TNF-alpha), also known as TNF, TNFA or TNFSF2,Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing
Konzentration: < 1 EU/µg of the protein by LAL method
Molekulargewicht: 17.23 kDa
NCBI: 24835
UniProt: P16599
Reinheit: > 95% by SDS-PAGE.
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Target-Kategorie: Tnf
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.