Recombinant Mouse Siglec-5/CD170 Protein, Human

Artikelnummer: ABB-RP01913
Artikelname: Recombinant Mouse Siglec-5/CD170 Protein, Human
Artikelnummer: ABB-RP01913
Hersteller Artikelnummer: RP01913
Alternativnummer: ABB-RP01913-20UG,ABB-RP01913-50UG,ABB-RP01913-500UG,ABB-RP01913-1000UG,ABB-RP01913-10UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Asp18-Thr437
Alternative Synonym: Sialic acid-binding Ig-like lectin 5, Siglec-5, Siglec-F, mSiglec-F, CD170
Siglecs (sialic acid binding Ig-like lectins) are I-type (Ig-type) lectins belonging to the Ig superfamily. They are characterized by an N-terminal Ig-like V-type domain which mediates sialic acid binding , followed by varying numbers of Ig-like C2-type domains. Eleven human Siglecs have been cloned and characterized . They are sialoadhesin/CD169/Siglec-1, CD22/Siglec-2, CD33/Siglec-3, Myelin-Associated Glycoprotein (MAG/Siglec-4a) and the Siglec-5 to 11. To date, no Siglec has been shown to recognized any cell surface ligand other than sialic acids, suggesting that interactions with glycans containing this carbohydrate are important in mediating the biological functions of Siglecs. Siglec-5 to 11 share a high degree of sequence similarity with CD33/Siglec-3 both in their extracellular and intracellular regions. They are collectively referred to as CD33-related Siglecs. One remarkable feature of the CD33-related Siglecs is their differential expression pattern within the hematopoietic system. This fact, together with the presence of two conserved immunoreceptor tyrosine-based inhibition motifs (ITIMs) in their cytoplasma tails, suggests that CD33-related Siglecs are involved in the regulation of cellular activation within the immune system. Human Siglec-5 cDNA encodes a 551 amino acid (aa) polypeptide with a hydrophobic signal peptide, an N-terminal Ig-like V-type domain, three Ig-like C2-type domains, a transmembrane region and a cytoplasma tail . Siglec-5 exists as a disulfide-linked homodimer on the cell surface and is expressed on monocytes, neutrophils and B cells . It binds equally well to both alpha 2,3- and alpha 2,6-linked sialic acid .
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 45.37 kDa
NCBI: 233186
UniProt: Q920G3
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: DGYSLSVTGSVTVQEGLCVFVACQVQYPNSKGPVFGYWFREGANIFSGSPVATNDPQRSVLKEAQGRFYLMGKENSHNCSLDIRDAQKIDTGTYFFRLDGSVKYSFQKSMLSVLVIALTEVPNIQVTSTLVSGNSTKLLCSVPWACEQGTPPIFSWMSSALTSLGHRTTLSSELNLTPRPQDNGTNLTCQVNLPGTGVTVERTQQLSVIYAPQKMTIRVSWGDDTGTKVLQSGASLQIQEGESLSLVCMADSNPP
Target-Kategorie: Siglec5, Siglecf
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens