Recombinant Human Integrin alpha V beta3 (ITGB3&ITGAV) Protein

Artikelnummer: ABB-RP01918
Artikelname: Recombinant Human Integrin alpha V beta3 (ITGB3&ITGAV) Protein
Artikelnummer: ABB-RP01918
Hersteller Artikelnummer: RP01918
Alternativnummer: ABB-RP01918-10UG,ABB-RP01918-1000UG,ABB-RP01918-50UG,ABB-RP01918-500UG,ABB-RP01918-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ala21-Asp718&Phe31-Val992
Alternative Synonym: ITGB3, GP3A, Integrin beta-3, Platelet membrane glycoprotein IIIa, GPIIIa, CD antigen CD61 & ITGAV,ITGAV, MSK8, VNRA, VTNR,Integrin alpha-V, Vitronectin receptor subunit alpha, CD51, Cleaved into: Integrin alpha-V heavy chain, Integrin alpha-V light chain
Integrin beta-3 & alpha-V/ITGB3/ITGAV) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 77.71 kDa(ITGB3), 111.94 kDa(ITGAV)
NCBI: 3690
UniProt: P05106
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: AGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFT
Target-Kategorie: ITGB3&amp;ITGAV
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens