Recombinant Mouse CCL7/MCP-3 Protein, Yeast

Artikelnummer: ABB-RP01923
Artikelname: Recombinant Mouse CCL7/MCP-3 Protein, Yeast
Artikelnummer: ABB-RP01923
Hersteller Artikelnummer: RP01923
Alternativnummer: ABB-RP01923-20UG,ABB-RP01923-50UG,ABB-RP01923-500UG,ABB-RP01923-1000UG,ABB-RP01923-10UG,ABB-RP01923-100UG
Hersteller: ABclonal
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Gln24-Pro97
Alternative Synonym: C-C motif chemokine 7, CCL7, chemokine (C-C motif) ligand 7, FIC, MARC, MCP-3, MCP3Monocyte chemotactic protein 3, MCP-3Small-inducible cytokine A7, MGC138465, Monocyte chemoattractant protein 3, NC28SCYA6, SCYA7MGC138463, small inducible cytokine A7 (monocyte chemotactic protein 3)
Mouse CCL7/MCP-3, a member of the beta subfamily of chemokines, was initially identified as a transcript that is induced in a mouse mast cell line after Fc epsilon RI triggering by IgE plus antigen.Mouse MARC/MCP-3 expression has also been detected during murine experimental allergic encephalomyelitis in the spinal cord, and in LPS-stimulated murine WEHI -3 cells and Swiss 3T3 cells where MARC expression is glucocorticoid-attenuated. Except for one amino acid subsititution, mouse MARC is identical to mouse FIC, the product of a growth factor-activated gene. Mouse CCR2, a mouse chemokine receptor, has been shown to bind JE/MCP-1 with high affinity and MARC/MCP-3 with lower affinity.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 9.35 kDa
NCBI: 20306
UniProt: Q03366
Reinheit: 95% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Target-Kategorie: Ccl7
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors