Recombinant Mouse Placenta growth factor/PLGF/PGF Protein, Human

Artikelnummer: ABB-RP01941
Artikelname: Recombinant Mouse Placenta growth factor/PLGF/PGF Protein, Human
Artikelnummer: ABB-RP01941
Hersteller Artikelnummer: RP01941
Alternativnummer: ABB-RP01941-500UG,ABB-RP01941-50UG,ABB-RP01941-10UG,ABB-RP01941-100UG,ABB-RP01941-1000UG,ABB-RP01941-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ala24-Pro158
Alternative Synonym: Pgf, Plgf,Placenta growth factor, PlGF
Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines. Alternative splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively. Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus. Human PlGF-1 shares 56%, 55%, 74% and 95% aa identity with the comparable isoform of mouse, rat, canine, and equine PlGF, respectively. PlGF is mainly found as variably glycosylated, secreted, 55-60 kDa disulfide linked homodimers. Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes, and some endothelial cells. Circulating PlGF increases during pregnancy, reaching a peak in mid-gestation, this increase is attenuated in preeclampsia. However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 18.04 kDa
NCBI: 18654
UniProt: P49764
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
Target-Kategorie: Pgf
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors