Recombinant Mouse Cripto/TDGF1 Protein, Human

Artikelnummer: ABB-RP01946
Artikelname: Recombinant Mouse Cripto/TDGF1 Protein, Human
Artikelnummer: ABB-RP01946
Hersteller Artikelnummer: RP01946
Alternativnummer: ABB-RP01946-50UG,ABB-RP01946-500UG,ABB-RP01946-10UG,ABB-RP01946-100UG,ABB-RP01946-1000UG,ABB-RP01946-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Arg26-Gln150
Alternative Synonym: Cripto, Tdgf1, Teratocarcinoma-derived growth factor, Cripto growth factor, Epidermal growth factor-like Cripto protein
Cripto/TDGF1 is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. TDGF1 is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. It is overexpressed in many types of cancers and acts as a growth factor for tumors. Cripto mutants display defects in mesoderm induction and heart morphogenesis, similar to phenotypes seen in Nodal mutants. Cripto can also activate mitogen-activated protein kinase (MAPK) and Akt pathways independently of Nodal by directly binding to a membrane-associated heparan sulfate proteoglycan, glypican-1.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 14.75 kDa
NCBI: 21667
UniProt: P51865
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ
Target-Kategorie: TDGF1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors