Recombinant Human CCL8/MCP-2 Protein, Yeast

Artikelnummer: ABB-RP01947
Artikelname: Recombinant Human CCL8/MCP-2 Protein, Yeast
Artikelnummer: ABB-RP01947
Hersteller Artikelnummer: RP01947
Alternativnummer: ABB-RP01947-20UG,ABB-RP01947-50UG,ABB-RP01947-500UG,ABB-RP01947-10UG,ABB-RP01947-100UG,ABB-RP01947-1000UG
Hersteller: ABclonal
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gln24-Pro99
Alternative Synonym: CCL8, MCP2, SCYA10, SCYA8,C-C motif chemokine 8, HC14, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, MCP-2, Small-inducible cytokine A8, Cleaved into: MCP-2(6-76)
MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 8.91 kDa
NCBI: 6355
UniProt: P80075
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequenz: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Target-Kategorie: CCL8
Application Verdünnung: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related