Recombinant Mouse CXCL4/PF-4 Protein, Human

Artikelnummer: ABB-RP01953
Artikelname: Recombinant Mouse CXCL4/PF-4 Protein, Human
Artikelnummer: ABB-RP01953
Hersteller Artikelnummer: RP01953
Alternativnummer: ABB-RP01953-1000UG,ABB-RP01953-10UG,ABB-RP01953-20UG,ABB-RP01953-50UG,ABB-RP01953-500UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Val30-Ser105
Alternative Synonym: Pf4, Cxcl4, Scyb4,Platelet factor 4, PF-4, C-X-C motif chemokine 4
Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. As a strong chemoattractant for neutrophils and fibroblasts, PF4 probably has a role in inflammation and wound repair.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 9.05 kDa
NCBI: 56744
UniProt: Q9Z126
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Target-Kategorie: CXCL4
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors