Recombinant Human Mature MIS/AMH Protein

Artikelnummer: ABB-RP01956
Artikelname: Recombinant Human Mature MIS/AMH Protein
Artikelnummer: ABB-RP01956
Hersteller Artikelnummer: RP01956
Alternativnummer: ABB-RP01956-10UG,ABB-RP01956-100UG,ABB-RP01956-1000UG,ABB-RP01956-50UG,ABB-RP01956-20UG,ABB-RP01956-500UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser452-Arg560
Alternative Synonym: Muellerian-inhibiting factor, Anti-Muellerian hormone, AMH, Muellerian-inhibiting substance, MIS,AMH, MIF
Anti-Mullerian hormone (AMH), a member of the TGF-beta superfamily, is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles. BMP15 up-regulates the transcription of AMH and that the inhibition of p38 MAPK decreases the BMP15-induced expression of AMH and SOX9, suggesting that BMP15 up-regulates the expression of AMH via the p38 MAPK signaling pathway, and this process involves the SOX9 transcription factor. AMH is widely used for assessing ovarian reserve, and it is particularly convenient, because it is thought to have minimal variability throughout the menstrual cycle. Fetal anti-Mullerian hormone (AMH) is responsible for normal male sexual differentiation, and circulating AMH is used as a marker of testicular tissue in newborns with disorders of sex development. Anti-Mullerian hormone (AMH) produced in the developing testis induces the regression of the Mullerian duct, which develops into the oviducts, uterus and upper vagina. As well as other hormone receptors, and a decreased ovarian cortex cell proliferation. These results help understand the inhibitory effects of AMH on follicular development.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 12.51 kDa
NCBI: 268
UniProt: P03971
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50mM acetic acid, pH 3.0.
Sequenz: SAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
Target-Kategorie: AMH
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50mM acetic acid, pH 3.0.
Anwendungsbeschreibung: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors