Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein

Artikelnummer: ABB-RP01961
Artikelname: Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein
Artikelnummer: ABB-RP01961
Hersteller Artikelnummer: RP01961
Alternativnummer: ABB-RP01961-20UG,ABB-RP01961-50UG,ABB-RP01961-500UG,ABB-RP01961-1000UG,ABB-RP01961-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: His25-103Gly
Alternative Synonym: ITPRIPL1, KIAA1754L,Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
ITPRIPL1/KIAA1754L/CD3L1 is a transmembrane protein with broad expression in the testis associated with immune evasion. In fact, ITPRIPL1 is a molecule specifically expressed in immune privileged tissues, ''hot tumors without PD-L1 expression, and non-responding tumors to PD-1 blockade therapy. ITPRIPL1 has been shown to impair T cell function in vitro and in vivo through CD3e with experimental evidence supporting a negative correlation between ITPRIPL1 expression level in antigen-presenting cells and T cell cytotoxicity. ITPRIPL1 was a hypermethylated-low expression gene in breast cancer and acted as an independent biomarker for the prognosis of lung adenocarcinoma by using bioinformatics methods. Thus, targeting the ITPRIPL1-CD3e axis, especially in PD-1 - PD-L1 negative patients, is a promising therapeutic strategy to reduce immune evasion.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 36.07 kDa
NCBI: 150771
UniProt: Q6GPH6
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
Target-Kategorie: ITPRIPL1/KIAA1754L
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein