Recombinant Human AMHR2/MISR2 Protein

Produktübersicht

• Artikelname: Recombinant Human AMHR2/MISR2 Protein
• Artikelnummer: ABB-RP01962
• Hersteller Artikelnummer: RP01962
• Alternativnummer: ABB-RP01962-20UG,ABB-RP01962-10UG,ABB-RP01962-100UG,ABB-RP01962-1000UG,ABB-RP01962-50UG,ABB-RP01962-500UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Immunogen: Pro18-Ser144
• Alternative Synonym: AMHR2, AMHR, MISR2,Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII

Produktbeschreibung

AMHR2,On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators.

Produkteigenschaften

• Konzentration: < 0.01 EU/µg of the protein by LAL method
• Molekulargewicht: 39.46 kDa
• NCBI: 269
• UniProt: Q16671
• Reinheit: 95 % as determined by SDS-PAGE.
• Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequenz: PNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
• Target-Kategorie: AMHR2

Anwendungsbeschreibung

• Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein