Recombinant Human Thy-1/CD90 Protein

Artikelnummer: ABB-RP01965
Artikelname: Recombinant Human Thy-1/CD90 Protein
Artikelnummer: ABB-RP01965
Hersteller Artikelnummer: RP01965
Alternativnummer: ABB-RP01965-100UG,ABB-RP01965-50UG,ABB-RP01965-500UG,ABB-RP01965-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gln20-Cys130
Alternative Synonym: THY1,Thy-1 membrane glycoprotein, CDw90, Thy-1 antigen, CD90
CD90, also known as Thy1, is an approximately 25-35 kDa glycoprotein that mediates cellular adhesion and exerts wide ranging effects in different tissues. CD90 is expressed on hematopoietic progenitor cells, neurons, and activated vascular endothelial cells. Its species-specific expression in lymphoid cells allows its use as a thymocyte and pan T cell marker in mouse but not in human. CD90 can form dimers and higher order multimers. It binds to heparin, the proteoglycan Syndecan-4, and Integrins alpha M beta 2, alpha V beta 3, and alpha V beta 5. Through these interactions, CD90 inhibits neurite outgrowth, promotes astrocyte adhesion, mediates the adhesion and extravasation of leukocytes and melanoma cells, supports the Thrombospondin-1 induced disassembly of fibroblast focal adhesions, and inhibits the activation of latent TGF-beta 1, myofibroblast differentiation, and lung fibrosis. Human Thy-1 shares 63% and 66% amino acids similarity with mouse and rat homolog.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 13.38 kDa
NCBI: 7070
UniProt: P04216
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Target-Kategorie: THY1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens