Recombinant Mouse Orosomucoid-1/ORM1 Protein, Human

Artikelnummer: ABB-RP01968
Artikelname: Recombinant Mouse Orosomucoid-1/ORM1 Protein, Human
Artikelnummer: ABB-RP01968
Hersteller Artikelnummer: RP01968
Alternativnummer: ABB-RP01968-20UG,ABB-RP01968-50UG,ABB-RP01968-500UG,ABB-RP01968-1000UG,ABB-RP01968-10UG,ABB-RP01968-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Gln19-207Ala
Alternative Synonym: Orm1,Agp1, Orm-1,Agp-1,Agp-2, Orm-1,Alpha-1-acid glycoprotein 1,AGP 1,Orosomucoid-1 (OMD 1)
Orosomucoid-1/ORM1 as a transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain , Appears to function in modulating the activity of the immune system during the acute-phase reaction
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 22.76 KDa
NCBI: 18405
UniProt: Q60590
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequenz: QNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA
Target-Kategorie: Orm1,Agp1, Orm-1
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein