Recombinant Human MMP-10 Protein

Artikelnummer: ABB-RP01969
Artikelname: Recombinant Human MMP-10 Protein
Artikelnummer: ABB-RP01969
Hersteller Artikelnummer: RP01969
Alternativnummer: ABB-RP01969-20UG,ABB-RP01969-50UG,ABB-RP01969-500UG,ABB-RP01969-10UG,ABB-RP01969-100UG,ABB-RP01969-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Tyr18-Cys476
Alternative Synonym: MMP10, STMY2,Stromelysin-2, SL-2, EC:3.4.24.22, Matrix metalloproteinase-10, MMP-10, Transin-2
Matrix metalloproteinases are a family of zinc and calcium dependent endopeptidases with the combined ability to degrade all the components of the extracellular matrix. MMP-10 degrades a broad range of substrates including gelatin, collagen types III, IV and V, fibronectin, aggrecan, and pig cartilage proteoglycan. MMP-10 can activate other MMPs such as MMP-1 and MMP-8. MMP-10 is expressed in keratinocytes, T cells, menstrual endometrium and a few tumor samples. Structurally, MMP-10 may be divided into four distinct domains: a pro-domain which is cleaved upon activation, a catalytic domain containing the zinc binding site, a short linker region, and a carboxyl terminal hemopexin-like domain.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 53.1 KDa
NCBI: 4319
UniProt: P09238
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of 150 mM NaCl, 5 mM CaCl2, 50 mM Tris, pH 7.5.
Sequenz: YPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEP
Target-Kategorie: MMP10, STMY2
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of 150 mM NaCl, 5 mM CaCl2, 50 mM Tris, pH 7.5.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein