Recombinant Human FCRL2/FCRH2 /IRTA4 Protein

Artikelnummer: ABB-RP01984
Artikelname: Recombinant Human FCRL2/FCRH2 /IRTA4 Protein
Artikelnummer: ABB-RP01984
Hersteller Artikelnummer: RP01984
Alternativnummer: ABB-RP01984-20UG,ABB-RP01984-100UG,ABB-RP01984-1000UG,ABB-RP01984-50UG,ABB-RP01984-500UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Leu20-Asp395
Alternative Synonym: FCRL2, FCRH2, IFGP4, IRTA4, SPAP1, UNQ9236/PRO31998, Fc receptor-like protein 2, FcR-like protein 2, FcRL2, Fc receptor homolog 2, FcRH2, IFGP family protein 4, Immunoglobulin receptor translocation-associated protein 4, SH2 domain-containing phosphatase anchor protein 1, CD307b
FCRL2/FCRH2 /IRTA4, belongs to the family of glycoprotein homologs of classical immunoglobulin (Ig) Fc receptors. In human, the type I transmembrane FCRL protein family contains from three to nine immunoglobulin-like domains . Mature human FcRH2 consists of a 382 amino acid (aa) extracellular domain (ECD) with four Ig-like C2-set domains, a 21 aa transmembrane segment, and an 86 aa cytoplasmic domain with one ITAM-like, and two ITIM-like motifs. Alternate splicing of human FCRL2 may generate isoforms with N-terminal, internal, or C-terminal deletions . The gene for FcRH2 maps to the human Iq21-23 locus which is a hotspot for chromosomal translocation events associated with B cell malignancies . Although there are several Fc receptor-like genes in the mouse, none of these is a clear ortholog to human FCRL2 . FCRL proteins are differentially expressed among B cells . FCRL2 is preferentially expressed on naive and CD27+ memory B cells within the spleen, lymph nodes, tonsils, and peripheral blood . It is also expressed on most B cells in B cell chronic lymphocytic leukemia (B-CLL) patients. FCRL2 upregulation is associated with mutation of the immunoglobulin heavy chain variable (IGHV) and less aggressive forms of B-CLL.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 41.89 KDa
NCBI: 79368
UniProt: Q96LA5
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequenz: LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYY
Target-Kategorie: FCRL2, FCRH2, IFGP4, IRTA4, SPAP1, UNQ9236/PRO31998
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens