Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein

Artikelnummer: ABB-RP01985
Artikelname: Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein
Artikelnummer: ABB-RP01985
Hersteller Artikelnummer: RP01985
Alternativnummer: ABB-RP01985-20UG,ABB-RP01985-10UG,ABB-RP01985-1000UG,ABB-RP01985-500UG,ABB-RP01985-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gly28-Asn93
Alternative Synonym: CCL14, NCC2, SCYA14,C-C motif chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14, Cleaved into: HCC-1(3-74), HCC-1(4-74), HCC-1(9-74)
Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It isproduced as a protein precursor that is processed to generate a mature active protein containing 74 aminoacids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed invarious tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does notinduce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokinesbelonging to the CC family.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 8.623 KDa
NCBI: 6358
UniProt: Q16627
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequenz: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Target-Kategorie: CCL14, NCC2, SCYA14
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors