Recombinant Human LRG1(P133S) Protein

Artikelnummer: ABB-RP01986
Artikelname: Recombinant Human LRG1(P133S) Protein
Artikelnummer: ABB-RP01986
Hersteller Artikelnummer: RP01986
Alternativnummer: ABB-RP01986-500UG,ABB-RP01986-50UG,ABB-RP01986-20UG,ABB-RP01986-10UG,ABB-RP01986-100UG,ABB-RP01986-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Vla36-Gln347(Pro133Ser)
Alternative Synonym: LRG1, LRG,Leucine-rich alpha-2-glycoprotein, LRG
Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 35.16 kDa
NCBI: 116844
UniProt: P02750
Reinheit: 90 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequenz: VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDM
Target-Kategorie: LRG1, LRG
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Biosimilar Drug Targets