Recombinant Human CD3 delta Protein

Artikelnummer: ABB-RP02006
Artikelname: Recombinant Human CD3 delta Protein
Artikelnummer: ABB-RP02006
Hersteller Artikelnummer: RP02006
Alternativnummer: ABB-RP02006-100UG,ABB-RP02006-1000UG,ABB-RP02006-500UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Phe22-Ala105
Alternative Synonym: CD3D,CD3-DELTA,IMD19,T3D, IMD19, T3D
T-cell surface glycoprotein CD3 delta chain, also known as CD3D, is a single-pass type I membrane protein.In immunology, the CD3 (cluster of differentiation 3) T cell co-receptor helps to activate both the cytotoxic T cell (CD8+ naive T cells) and also T helper cells (CD4+ naive T cells). It consists of a protein complex and is composed of four distinct chains. In mammals, the complex contains a CD3gamma chain, a CD3delta chain, and two CD3epsilon chains.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 10.4 kDa
NCBI: 915
UniProt: P04234
Reinheit: 95 % as determined by SDS-PAGE,95 % as determined by HPLC.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequenz: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
Target-Kategorie: CD3 delta/CD3D
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens