Recombinant Cynomolgus CD3E&CD3G Protein, Human

Artikelnummer: ABB-RP02060
Artikelname: Recombinant Cynomolgus CD3E&CD3G Protein, Human
Artikelnummer: ABB-RP02060
Hersteller Artikelnummer: RP02060
Alternativnummer: ABB-RP02060-100UG,ABB-RP02060-1000UG,ABB-RP02060-500UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Monkey
Immunogen: Gln22-Asp117(Q95LI52)&Gln23-Thr113(Q95LI7)
Alternative Synonym: CD3E&CD3G,CD3 epsilon&CD3 gamma
T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 36.9 kDa (CD3E), 36.5 kDa (CD3G).
NCBI: 102133065
UniProt: Q95LI5
Reinheit: 95 % as determined by SDS-PAGE,95 % as determined by HPLC.
Formulierung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Sequenz: QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDQSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Target-Kategorie: CD3E&amp;CD3G
Application Verdünnung: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens