Recombinant Human IL-27RA/TCCR Protein

Artikelnummer: ABB-RP02418
Artikelname: Recombinant Human IL-27RA/TCCR Protein
Artikelnummer: ABB-RP02418
Hersteller Artikelnummer: RP02418
Alternativnummer: ABB-RP02418-500UG,ABB-RP02418-100UG,ABB-RP02418-1000UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gly34-Lys516
Alternative Synonym: IL27RA,CRL1,IL-27RA,IL27R,TCCR,WSX1,zcytor1
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 79.3 kDa
NCBI: 9466
UniProt: Q6UWB1
Reinheit: 95 % as determined by Tris-Bis PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: GSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLEPELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSGNLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGITCCCSL
Target-Kategorie: IL-27RA/TCCR
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Interleukin