Recombinant Human Mature BMP-7 Protein

Artikelnummer: ABB-RP02513S
Artikelname: Recombinant Human Mature BMP-7 Protein
Artikelnummer: ABB-RP02513S
Hersteller Artikelnummer: RP02513S
Alternativnummer: ABB-RP02513S-20UG,ABB-RP02513S-50UG,ABB-RP02513S-500UG,ABB-RP02513S-1000UG,ABB-RP02513S-10UG,ABB-RP02513S-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser293-His431
Alternative Synonym: BMP7, OP1,Bone morphogenetic protein 7, BMP-7, Osteogenic protein 1, OP-1, Eptotermin alfa
BMP-7 (Bone morphogenetic protein 7) is a bone morphogenetic protein which belongs to the TGF-beta superfamily. OP-1 is expressed in the brain, kidneys, and bladder. BMP-7 may be involved in bone homeostasis and plays a key role in the transformation of mesenchymal cells into bone and cartilage. The phosphorylation of SMAD1 and SMAD5 can be induced by BMP-7, which in turn induce transcription of numerous osteogenic genes. BMP-7 treatment can also induce all of the genetic markers of osteoblast differentiation in many cell types. Human recombinant BMP-7 protein can be used to aid in the fusion of vertebral bodies to prevent neurologic trauma. It also functions in the treatment of tibial non-union, frequently in cases where a bone graft has failed. It is found that BMP7 has the potential for treatment of chronic kidney disease.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 15.68 kDa
NCBI: 655
UniProt: P18075
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 50mM acetic acid,pH3.6.
Sequenz: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Target-Kategorie: BMP-7
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 50mM acetic acid,pH3.6.
Anwendungsbeschreibung: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors