Recombinant Mouse IL-18 Protein, Human

Artikelnummer: ABB-RP02521
Artikelname: Recombinant Mouse IL-18 Protein, Human
Artikelnummer: ABB-RP02521
Hersteller Artikelnummer: RP02521
Alternativnummer: ABB-RP02521-10UG,ABB-RP02521-1000UG,ABB-RP02521-20UG,ABB-RP02521-50UG,ABB-RP02521-500UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Asn36-Ser192
Alternative Synonym: Ig, Il-, Igif, Il-18,IL18
Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-gamma (IFN-gamma) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 18.96 kDa
NCBI: 16173
UniProt: P70380
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 8.0.
Sequenz: NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Target-Kategorie: IL-18
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 8.0.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Interleukin