Recombinant Human GFR alpha-like/GFRAL Protein

Artikelnummer: ABB-RP02625
Artikelname: Recombinant Human GFR alpha-like/GFRAL Protein
Artikelnummer: ABB-RP02625
Hersteller Artikelnummer: RP02625
Alternativnummer: ABB-RP02625-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser19-Glu351
Alternative Synonym: GFR alpha-like, GFRAL, GRAL, C6orf144
GFR alpha -like (GDNF receptor-alpha-like) is a distant member of the GDNFR family of proteins. Mature human GFR alpha-like is a 376 amino acid (aa) type I transmembrane protein. It contains a 333 aa extracellular domain, a 20 aa transmembrane domain and a 23 aa cytoplasmic domain.GFRAL is a brainstem-restricted receptor for GDF15 which regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 64.6 kDa
NCBI: 389400
UniProt: Q6UXV0
Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequenz: SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSD
Target-Kategorie: GFRAL/GFR alpha-like
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein