Recombinant Cynomolgus/Rhesus macaque TNFRSF9/4-1BB Protein, Human

Produktübersicht

• Artikelname: Recombinant Cynomolgus/Rhesus macaque TNFRSF9/4-1BB Protein, Human
• Artikelnummer: ABB-RP02643
• Hersteller Artikelnummer: RP02643
• Alternativnummer: ABB-RP02643-100UG
• Hersteller: ABclonal
• Wirt: Human
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Monkey
• Immunogen: Leu24-Gln186
• Alternative Synonym: CD137, TNFRSF9, 4-1BB ligand receptor, 41BB, 4-1BB, CDw137, FLJ43501, ILA, T cell antigen ILA

Produktbeschreibung

4-1BB, is also known as CD137, is a type 2 transmembrane glycoprotein receptor belonging to the TNF superfamily.CD137 can be expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, CD137 expression is found on dendritic cells, B cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation.

Produkteigenschaften

• Konzentration: < 1 EU/µg of the protein by LAL method.
• Molekulargewicht: 18.4 kD
• NCBI: 102127961
• UniProt: XP_005544945.1
• Reinheit: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Sequenz: LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ
• Target-Kategorie: Cynomolgus/Rhesus macaque 4-1BB/TNFRSF9

Anwendungsbeschreibung

• Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein