Recombinant Human CRTAM/CD355 (A65V) Protein

Artikelnummer: ABB-RP02670
Artikelname: Recombinant Human CRTAM/CD355 (A65V) Protein
Artikelnummer: ABB-RP02670
Hersteller Artikelnummer: RP02670
Alternativnummer: ABB-RP02670-10UG, ABB-RP02670-50UG, ABB-RP02670-100UG, ABB-RP02670-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Ser18-Gly287
Alternative Synonym: CD355 antigen, CD355, CRTAM
Class-I Restricted T Cell-Associated Molecule (CRTAM) is a protein that is expressed after T cell activation. The interaction of CRTAM with its ligand, nectin-like 2 (Necl2), is required for the efficient production of IL-17, IL-22, and IFNgamma by murine CD4 T cells, and it plays a role in optimal CD8 T and NK cell cytotoxicity. CRTAM promotes the pro-inflammatory cytokine profile, therefore, it may take part in the immunopathology of autoimmune diseases such as diabetes type 1 or colitis.
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 30.77 kDa
NCBI: 56253
UniProt: O95727
Reinheit: 95 % as determined by SDS-PAGE.
Sequenz: LTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTE
Target-Kategorie: CRTAM
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens