Recombinant Mouse NKG2-D/KLRK1/CD314 Protein, Human

Artikelnummer: ABB-RP02720
Artikelname: Recombinant Mouse NKG2-D/KLRK1/CD314 Protein, Human
Artikelnummer: ABB-RP02720
Hersteller Artikelnummer: RP02720
Alternativnummer: ABB-RP02720-10UG, ABB-RP02720-50UG, ABB-RP02720-20UG, ABB-RP02720-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Phe90-Val232
Alternative Synonym: CD314, D12S2489E, KLR, NKG2-D, NKG2D
NKG2D is a type II transmembrane glycoprotein having an extracellular lectin-like domain. This domain lacks the recognizable calcium-binding sites found in true C-type lectins and binds protein rather than carbohydrate ligands. Human NKG2D is expressed on CD8 alpha beta T cells, gamma delta T cells, NK cells and NKT cells.
Konzentration: < 0.1 EU/µg of the protein by LAL method.
Molekulargewicht: 42.38 kDa
NCBI: 27007
UniProt: O54709
Reinheit: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
Sequenz: FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
Target-Kategorie: NKG2D/CD314
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens