Recombinant Mouse IL-21 Protein, Chinese Hamster

Artikelnummer: ABB-RP02775S
Artikelname: Recombinant Mouse IL-21 Protein, Chinese Hamster
Artikelnummer: ABB-RP02775S
Hersteller Artikelnummer: RP02775S
Alternativnummer: ABB-RP02775S-10UG,ABB-RP02775S-50UG,ABB-RP02775S-20UG
Hersteller: ABclonal
Wirt: Chinese Hamster
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ser21-Ser146
Alternative Synonym: Interleukin-21, IL-21,Il21
IL21 belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. IL21 is expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes. It may promote the transition between innate and adaptive immunity. IL-21 has been tried as a therapy for alleviating allergic responses. It can significantly decrease pro-inflammatory cytokines produced by T cells in addition to decreasing IgE levels in a mouse model for rhinitis (nasal passage inflammation).
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 15.43 kDa
NCBI: 60505
UniProt: Q9ES17
Reinheit: 85 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: SPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Target-Kategorie: IL21
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors