Recombinant Human Tenascin C/TNC Protein

Artikelnummer: ABB-RP02798
Artikelname: Recombinant Human Tenascin C/TNC Protein
Artikelnummer: ABB-RP02798
Hersteller Artikelnummer: RP02798
Alternativnummer: ABB-RP02798-50UG, ABB-RP02798-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Gly23-Ser621
Alternative Synonym: TNC, HXB, Tenascin, TN, Cytotactin, GMEM, GP 150-225, Glioma-associated-extracellular matrix antigen, Hexabrachion, JI, Myotendinous antigen, Neuronectin, Tenascin-C, TN-C
Tenascin C/TNC is a member of the Tenascin family of extracellular matrix proteins. It is secreted as a disulfide-linked homohexamer whose subunits can vary in size from approximately 200 kDa to over 300 kDa due to differences in glycosylation. Hman Tenascin C monomer is synthesized as a precursor with a 22 amino acid (aa) signal sequence and a 2179 aa mature chai). Mature human Tenascin C (isoform 1) shares 84% aa sequence identity with mature mouse Tenascin C. In the developing embryo, Tenascin C is expressed during neural, skeletal, and vascular morphogenesis . In the adult, it virtually disappears with continued basal expression detectable only in tendon-associated tissues. However, greatup-regulation in expression occurs in tissues undergoing remodeling processes seen during wound repair and neovascularization or in pathological states such as inflammation or tumorigenesis .
Konzentration: < 0.01 EU/µg of the protein by LAL method
Molekulargewicht: 65.27 kDa
NCBI: 3371
UniProt: P24821
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: GVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGD
Target-Kategorie: TNC/HXB
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein