Recombinant Mouse Progranulin/PGRN/GRN Protein, Human

Artikelnummer: ABB-RP02801
Artikelname: Recombinant Mouse Progranulin/PGRN/GRN Protein, Human
Artikelnummer: ABB-RP02801
Hersteller Artikelnummer: RP02801
Alternativnummer: ABB-RP02801-100UG, ABB-RP02801-50UG, ABB-RP02801-10UG, ABB-RP02801-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Thr18-Leu589
Alternative Synonym: Grn,Progranulin, PGRN, Acrogranin, Epithelin/granulin precursor, GP88, Glycoprotein 88, PC cell-derived growth factor, PCDGF, Proepithelin, PEPI
Granulin family members are important in normal development, wound healing, and tumorigenesis. Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling. Granulin-4 promotes proliferation of the epithelial cell line A431 in culture while granulin-3 acts as an antagonist to granulin-4, inhibiting the growth. Granulin expression inhibited Tat transactivation, and tethering experiments showed that this effect was due, at least in part, to a direct action on cyclin T1 in the absence of Tat.
Konzentration: < 0.01 EU/µg of the protein by LAL method.
Molekulargewicht: 62.47 kDa
NCBI: 14824
UniProt: P28798
Reinheit: 90% as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Sequenz: TQCPDGQFCPVACCLDQGGANYSCCNPLLDTWPRITSHHLDGSCQTHGHCPAGYSCLLTVSGTSSCCPFSKGVSCGDGYHCCPQGFHCSADGKSCFQMSDNPLGAVQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDLLTKL
Target-Kategorie: Grn
Application Verdünnung: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors