Recombinant Mouse Vitronectin/V75/VTN Protein, Human

Artikelnummer: ABB-RP02818
Artikelname: Recombinant Mouse Vitronectin/V75/VTN Protein, Human
Artikelnummer: ABB-RP02818
Hersteller Artikelnummer: RP02818
Alternativnummer: ABB-RP02818-100UG,ABB-RP02818-20UG,ABB-RP02818-50UG,ABB-RP02818-10UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Asp20-Lys478
Alternative Synonym: V75, VN, VNT,VTN,VN,VNT
Vitronectin, also known as VTN, is a member of the pexin family. It is an abundant glycoprotein found in serum the extracellular matrix and promotes cell adhesion and spreading. Vitronectin is a secreted protein and exists in either a single chain form or a cleaved, two chain form held together by a disulfide bond. Vitronectin is a plasma glycoprotein implicated as a regulator of diverse physiological process, including blood coagulation, fibrinolysis, pericellular proteolysis, complement dependent immune responses, and cell attachment and spreading. Because of its ability to bind platelet glycoproteins and mediate platelet adhesion and aggregation at sites of vascular injury, vitronectin has become an important mediator in the pathogenesis of coronary atherosclerosis. As a multifunctional protein with a multiple binding domain, Vitronectin interacts with a variety of plasma and cell proteins. Vitronectin binds multiple ligands, including the soluble vitronectin receptor. It may be an independent predictor of adverse cardiovascular outcomes following acute stenting. Accordingly, Vitronectin is suggested to be involved in hemostasis, cell migration, as well as tumor malignancy.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 53.59 kDa
Tag: C-His
NCBI: 22370
UniProt: P29788
Quelle: HEK293 Cells
Reinheit: 85 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: DQESCKGRCTQGFMASKKCQCDELCTYYQSCCADYMEQCKPQVTRGDVFTMPEDDYWSYDYVEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPTAFLDPEEQPSTPAPKVEQQEEILRPDTTDQGTPEFPEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPGYPRNISEGFSGIPDNVDAAFALPAHRYSGRERVYFFK
Target-Kategorie: Vitronectin/V75/VTN
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors