Recombinant Mouse Asprosin/Fibrillin-1/FBN1 Protein, Human

Artikelnummer: ABB-RP02819
Artikelname: Recombinant Mouse Asprosin/Fibrillin-1/FBN1 Protein, Human
Artikelnummer: ABB-RP02819
Hersteller Artikelnummer: RP02819
Alternativnummer: ABB-RP02819-10UG, ABB-RP02819-50UG, ABB-RP02819-20UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Ser2734-His2873
Alternative Synonym: Fibrillin-1,Fbn1,Asprosin,Fbn-1,FBN1
Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 16.73 kDa
NCBI: 14118
UniProt: Q61554
Reinheit: 90% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: STNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH
Target-Kategorie: Asprosin/Fibrillin-1/FBN1
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors