Recombinant Human MME/Neprilysin/CD10 Protein

Artikelnummer: ABB-RP02826
Artikelname: Recombinant Human MME/Neprilysin/CD10 Protein
Artikelnummer: ABB-RP02826
Hersteller Artikelnummer: RP02826
Alternativnummer: ABB-RP02826-50UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Immunogen: Tyr52-Trp750
Alternative Synonym: MME, EPN
The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alters the behavior of the cell. Some CD proteins do not take part in the cell signal process but have other functions such as cell adhesion. The cluster of differentiation 10 (CD10), also known as Neprilysin and neutral endopeptidase, is a member of the CD system. CD10 is a zinc-dependent metalloprotease enzyme that had the function to degrade some small secreted peptides such as the amyloid beta-peptide. It exists as a membrane-bound protein and has a high concentration in kidney and lung tissues. Mutations in the CD10 gene can induce the familial forms of Alzheimers disease, providing strong evidence for the proteins association with the Alzheimers disease process. CD10 is also associated with other biochemical processes.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 82.2 kDa
Tag: C-His
NCBI: 4311
UniProt: P08473
Quelle: HEK293 Cells
Reinheit: 95 % as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of 20mM MES, 100mM NaCl, 1mM ZnCl2, 10%glycerol, pH 6.5.
Sequenz: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTLA
Target-Kategorie: CD10/MME
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of 20mM MES, 100mM NaCl, 1mM ZnCl2, 10%glycerol, pH 6.5.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Human MME/CD10 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.