Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein, Human

Artikelnummer: ABB-RP02829
Artikelname: Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein, Human
Artikelnummer: ABB-RP02829
Hersteller Artikelnummer: RP02829
Alternativnummer: ABB-RP02829-50UG,ABB-RP02829-20UG,ABB-RP02829-10UG,ABB-RP02829-100UG
Hersteller: ABclonal
Wirt: Human
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Immunogen: Pro132-Leu279
Alternative Synonym: FASLG,ALPS1B,APT1LG1,APTL,CD178,CD95-L,CD95L,FASL,TNFSF6,TNLG1A,Fas ligand,FasL,FasLG,Faslg
Fas Ligand, also known as FASLG and CD95L, is the ligand for FAS. It is a transmembrane protein which binds to TNFRSF6/FAS. Interaction of FAS with fas Ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Fas Ligand may be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.
Konzentration: < 1 EU/µg of the protein by LAL method.
Molekulargewicht: 17.75 kDa
Tag: N-His
NCBI: 14103
UniProt: P41047
Quelle: Yeast
Reinheit: 95% as determined by SDS-PAGE.
Formulierung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequenz: PSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
Target-Kategorie: Fas ligand/APTL/CD95 ligand/CD178
Application Verdünnung: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Anwendungsbeschreibung: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: TNF family